SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985623|ref|YP_604987.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985623|ref|YP_604987.1|
Domain Number 1 Region: 5-470
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 1.4e-58
Family Outer membrane efflux proteins (OEP) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985623|ref|YP_604987.1|
Sequence length 472
Comment outer membrane efflux protein [Deinococcus geothermalis DSM 11300]
Sequence
MTSPPLRLRRPAPWLLTLALLMGAAQAQTATQTPPPTPAIPATPATTLTLEAALARLAQA
PSVTQAQLSVQVAQQNLNAARSALGLSVSVTGNAGYTGPFTTTAADGTTTTTASSLSGSA
GVQASLGLLPWSSGQASLRAAERSLALAQANLAAAQASARLNVYQQYLAAVVAQQDVTLA
QQTLTLRQRQLEIARTQRAQNNATQESVLTAQANVQLAQGALAEAQSSLESARLNLAAVL
GQSLTGVTFSTLPPETFTLPDLNTLVARARTSTVDVVKAQNDLATAQETLEEQERDQRLP
DLTASLRYGPAGSGGLSASLDVKAGTAGLGYTVPLGSSSGSAGSNRVVASISGSYVVYSP
ALRAQLSAAQANVTQAQLTVQVAQQNAELNVRTLYSAAQTNLTALQASATQVEVARTALS
TAQARLQAGTGTAEDVTSAQLALAQAERNLVQARATAQLALIRLINAAGGSS
Download sequence
Identical sequences Q1IY66
WP_011530652.1.71355 gi|94985623|ref|YP_604987.1| 319795.Dgeo_1523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]