SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985656|ref|YP_605020.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985656|ref|YP_605020.1|
Domain Number 1 Region: 15-207
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 6.21e-61
Family Mug-like 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985656|ref|YP_605020.1|
Sequence length 230
Comment phage SPO1 DNA polymerase-related protein [Deinococcus geothermalis DSM 11300]
Sequence
MTRGAGRQAADVIALEALEQQAKSCAACKLRPGCTQVVVSDGDPAAPLVIIGEGPGGDED
RLGRPFVGRAGQLLDRILAAVNLTRQDAYFTNIVKCRPPGNRAPEPDETAICTELWLEPQ
LALLRPRVILSLGNTPTQYLLGTRQGITRTRGQWYPYRHATAQGGSYQALLMPMFHPAYL
LRNDTRAPGGPKSLTWRDIREVAAVLRGAKEPEGLAPAVPPGEPGQPRLF
Download sequence
Identical sequences Q1IY33
WP_011530685.1.71355 gi|94985656|ref|YP_605020.1| 319795.Dgeo_1556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]