SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985680|ref|YP_605044.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985680|ref|YP_605044.1|
Domain Number 1 Region: 56-155
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000235
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 
Domain Number 2 Region: 200-297
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000017
Family Multidrug resistance efflux transporter EmrE 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985680|ref|YP_605044.1|
Sequence length 303
Comment hypothetical protein Dgeo_1580 [Deinococcus geothermalis DSM 11300]
Sequence
MGGYALPVTSLAARSARLTPAVLLALAIVYVVWGSTYFGIKVAIESIPPLGMLGVRFLLA
GGLLYGLLRWRGVPAPSAREWRASAVVGLLLLGGGTGLVTLAERDASSSVAAMMIAVSPL
FAALFARLWGERTGGREWLGIAVGLIGIALLNVGELHATPLAAFLLLLAPLCWTFGSQWS
RHLPLPRGLMGSAAEMLTGGALLLLLSLGLREHWSAPTAASLWALAYLTVFGSLVAYSAY
MYLVAHTRPALATSYAYVNPVVAVLLGVGLGGERLSSLGWAALGVILAGVVLVALPRSAA
AEA
Download sequence
Identical sequences Q1IY09
319795.Dgeo_1580 gi|94985680|ref|YP_605044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]