SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985686|ref|YP_605050.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985686|ref|YP_605050.1|
Domain Number 1 Region: 5-266
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.24e-37
Family YhfI-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985686|ref|YP_605050.1|
Sequence length 267
Comment beta-lactamase-like protein [Deinococcus geothermalis DSM 11300]
Sequence
MNGTLTFLGSADSKGVPRFWCDCPVCAEARTSGVNRRTRSAALVRGAEPSTGELQTLLLD
CGPDLHAQLARLPGPLVPDAVLISHAHNDHVLGLGDLLDYVGYAGERLHVYAPAAVIPDI
QDRFRYAFRSAAPVWPLPEEGLEVAGLRVRAFRVPHGANGHSHAFRLDRPGFAAAYVTDA
IDIPAEVIGRWLTNLDLLILGTSFADESRVPHAGRSVYDVREALALPWAQAVRRVFLTHL
SHDVDVRTRPLPRNWSWAHDGLELPLG
Download sequence
Identical sequences Q1IY03
WP_011530715.1.71355 gi|94985686|ref|YP_605050.1| 319795.Dgeo_1586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]