SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94985692|ref|YP_605056.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|94985692|ref|YP_605056.1|
Domain Number - Region: 32-149
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 0.0811
Family Proton glutamate symport protein 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985692|ref|YP_605056.1|
Sequence length 152
Comment hypothetical protein Dgeo_1592 [Deinococcus geothermalis DSM 11300]
Sequence
MQGTLEAGRVSCPCGRLERRATSQGHLCQHAGVNPLLLRSMLVTGLLIAVLNVIFAAVDY
GFANLPPWFWLAQLLLLPAMLAPARLFPQAMHTRAYLSRAWLYGLGWAAPYTVYKLTSDA
LNPNFSVGASLMAVVITCLLFGLIFAALRKPQ
Download sequence
Identical sequences Q1IXZ7
319795.Dgeo_1592 gi|94985692|ref|YP_605056.1| WP_011530721.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]