SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985724|ref|YP_605088.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985724|ref|YP_605088.1|
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-55
Family G proteins 0.00016
Further Details:      
 
Domain Number 2 Region: 164-287
Classification Level Classification E-value
Superfamily Translation proteins 1.24e-30
Family Elongation factors 0.0035
Further Details:      
 
Domain Number 3 Region: 398-492
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.83e-26
Family EF-G/eEF-2 domains III and V 0.0072
Further Details:      
 
Domain Number 4 Region: 290-369
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.26e-18
Family EF-G/eEF-2 domains III and V 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985724|ref|YP_605088.1|
Sequence length 595
Comment GTP-binding protein LepA [Deinococcus geothermalis DSM 11300]
Sequence
MNVRNFSIIAHVDHGKSTLADRILERLGAMGERDKRDQTLDTLELERERGITIKSTPIRL
TYRRANGEEYTFNLIDTPGHVDFGYEVSRSLAACEGVLLLVDASQGVEAQTIVNAYLAID
NNLEIIPVVNKIDLPAADPEGAAQELEEVIGIPAEEAVFASGKTGQGVDQILEAIVERIP
PPPGDPQAPLKALIFDSFYDAYQGVILFVRVLEGTLKPKQKIMLFSNGKSFEVDKVGTFS
PGLVVGDALSAGAVGWVAASIKDIHDAQVGDTITEKDRPTAEPFPGFKPAQPVVFSGLYP
TDTEDYRKLREALEKLKLNDAAFTFEPETSEALGFGFRCGFLGLLHAEIVQERLEREFDL
DLIATAPAVVYRVTLTNGEVFETQNPAEFPTRDRIARVEEPYIKLSIMLPEEYVGPVMQL
LQERRGNMVTMNYVGKRVELIYEVPFAEILYDFHDRLKSISRGYASMDYEQIGYREGDLR
KVDILVNGEVVDALAVIVHEDKAYSLGRKIVDKMAEVIPRQLFPVPVQAAIGGKIIARAT
VKAYRKDVLAKCYGGDITRKKKLLEKQKKGRARMKQIGTVEVPQEAFLAVLSTEE
Download sequence
Identical sequences Q1IXW5
319795.Dgeo_1624 gi|94985724|ref|YP_605088.1| WP_011530753.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]