SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985731|ref|YP_605095.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985731|ref|YP_605095.1|
Domain Number 1 Region: 106-320
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 5.49e-53
Family MurCDEF 0.0000668
Further Details:      
 
Domain Number 2 Region: 321-462
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 5.04e-38
Family MurCDEF C-terminal domain 0.00054
Further Details:      
 
Domain Number 3 Region: 20-104
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 4.05e-23
Family MurCD N-terminal domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985731|ref|YP_605095.1|
Sequence length 465
Comment UDP-N-acetylmuramate--L-alanine ligase [Deinococcus geothermalis DSM 11300]
Sequence
MTDSPPCSSDSASSVPSQLHYHLMGIGGIGVSAFARLLAARGVRVSGCDTQPSELTEQLV
REGIPVALGHDPAHVTGVDVLIASEAVPKNHPELVAARGAGVEVRPRMALLDELLRAGPS
VGVIGTHGKTTTTSMIAVAMQGAGLDPAAFVGGIVPEFGSNVRLGTGPFVAEVDESDRGF
AVLSCETAVFTNAEDDHVGGNQATYWETVEQQHAAFARFVGQARRVLYCADWPGLDQLVT
TSGERLNYGLAEGADYRAVDLRPDAEGTTFTVARRGEVLGEARVGLPGLHNVLNALAALA
VTDLYGGNFQTAAAALAAFRGPGRRWQRIGELNGALIIDDYAHNATKVAAAVQAARQTGR
RVRVVFQPHRYLRTQQSWPRLADALMGADEVLVLDIATASEPPIPGIHATLVSDRMAQSG
HTGVRYAPDRAEVVRYLRETACADDVIVTMGAGDVWKLSRELASV
Download sequence
Identical sequences Q1IXV8
gi|94985731|ref|YP_605095.1| WP_011530760.1.71355 319795.Dgeo_1631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]