SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985732|ref|YP_605096.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985732|ref|YP_605096.1|
Domain Number 1 Region: 19-203
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.61e-25
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 209-292
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 5.1e-25
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985732|ref|YP_605096.1|
Sequence length 295
Comment UDP-N-acetylenolpyruvoylglucosamine reductase [Deinococcus geothermalis DSM 11300]
Sequence
MTASSVTSSRTGARVERLPLARFTTLGVGGEAEVWFVDNHEQLAEALEQPYRILGGGSNL
VVADEGVPERVIRLTGRLAAADLTPDPDLSSTETVVTGWVGGGVPLPGLIRRLQKLGLSN
LEGTVGIPAQVGGAVWMNAGTRYGEMFDGLHTLEIVSPEGMRQVTPDELDWGYRRSGIPR
GHVVTRVRLKLRRSTPEAVLAKMALADQARKGQPKMKTPGCAFKNPGGVSAGKLIDEAGL
KGTRIGNAMIAPEHGNFIVNLGGASSRDIHALLALIRARVGVPLELEYELWPEQA
Download sequence
Identical sequences Q1IXV7
WP_011530761.1.71355 gi|94985732|ref|YP_605096.1| 319795.Dgeo_1632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]