SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985801|ref|YP_605165.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|94985801|ref|YP_605165.1|
Domain Number - Region: 220-287
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.0458
Family Thermostable phytase (3-phytase) 0.053
Further Details:      
 
Domain Number - Region: 171-225,256-320
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0837
Family Galactose oxidase, central domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985801|ref|YP_605165.1|
Sequence length 376
Comment hypothetical protein Dgeo_1701 [Deinococcus geothermalis DSM 11300]
Sequence
MLRRSALYLLLPVSAALMMGCGSTPQASLPSSGQNQSSQNTTNVEGIISPSVQGEARQKL
VSFLKSLPDTGDKIDRVILVDVDSGLLSQGLSQTPSVVASDTADASKYIEPFTKKVQRED
NGPEMGQLNLGLCGDASTNKTGFYSRRSAEQQYAGFKASLVLPSSFTKASASDSLYMYGS
IYDRLGSQGVEIGLVWKPSASKWVAYMSLNGYYPNASSTATTYDAKGVLLPVIQYDTGAT
AIYKMTDFRDASNTNIFYVSANFDGTVVAYRYSSSNDTTGVTPPTNLNPSSGYSRIGVRA
ITSIANGGQATTGSYMFGGQYANMQLITGVSNGTTTGTTTIDWTPTQTTENCVNNTTKVN
ASNPLPTKIYTNIDLR
Download sequence
Identical sequences Q1IXN8
gi|94985801|ref|YP_605165.1| 319795.Dgeo_1701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]