SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985816|ref|YP_605180.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985816|ref|YP_605180.1|
Domain Number 1 Region: 5-405
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.81e-120
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000281
Further Details:      
 
Domain Number 2 Region: 389-503
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.81e-28
Family Anticodon-binding domain of Class II aaRS 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985816|ref|YP_605180.1|
Sequence length 504
Comment glycyl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MPATSMEELVSLCKRRGFIFQGSEIYGGLQGFWDYGPLGVELKNNIKASWWRANVYERDD
MEGLDAAIIMHRLVLRHSGHEATFSDPMVDNRKTKKRYRLDHLVKDQKPDVVAQVAEGIG
ESVENFAAVVAALVAHPAKAAEVLVAAGVRDPFSGEVGDWTEPRPFNMMFKTSIGPVADE
DSFGYLRPETAQGIFTNFKNVVDSTSRRLPFGIAQIGKAFRNEITPRNFIFRVRELEQME
IEFFCTPGTDEAWHQHWLEARLAWWEAQGIPREKIQILDVPKEDLAHYSKRTYDLMYNYP
TLGYEEIEGIANRTDFDLGSHTKAQAELGIQARVEENFDSVAKLTIPHPETNKPVVPFVI
EPSAGVDRAMLAVLAEAYTKETLENGSERIVLKLKPHLAPIKVAVIPLARNREEITSVAK
AIKAKLQSLGLGRVLYEDSGNIGKAYRRHDEVGTPYCVTVDFETVGKGEDPALTDTVTVR
DRDTLGQERVRISELANWLQARLR
Download sequence
Identical sequences Q1IXM3
WP_011530842.1.71355 gi|94985816|ref|YP_605180.1| 319795.Dgeo_1716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]