SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985820|ref|YP_605184.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985820|ref|YP_605184.1|
Domain Number 1 Region: 54-142
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00000000131
Family Sulfiredoxin-like 0.086
Further Details:      
 
Weak hits

Sequence:  gi|94985820|ref|YP_605184.1|
Domain Number - Region: 155-225
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.0114
Family Zn metallo-beta-lactamase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985820|ref|YP_605184.1|
Sequence length 309
Comment hypothetical protein Dgeo_1720 [Deinococcus geothermalis DSM 11300]
Sequence
MSELNPRTQARHEVERARFLADVYDLLAILRREPNELLPFDWVQHLAPEGEHSLGVQAIP
VDQIIGSVDRYREFDRHYLPREPHLDERWIGVRAAQLQGKELPPIQVYKVGDLYFVKDGN
HRVSVARRQGQHYIDAHVIELQVAVPPNEHDTLRDLIIKGEYARFLKETNLDRVVPGHRQ
ILFTTPGRYDRLLEHIRTRQYFLDRKPERAGLPPVTWEEAVESWYRRLYSRVIENIEKHD
VMARFPGRTEADLYLWIMDHRYFLTEKYGHDVGSEEATRDFRARHAPPLYKRVSERMRLL
WHGRLNPAR
Download sequence
Identical sequences Q1IXL9
319795.Dgeo_1720 gi|94985820|ref|YP_605184.1| WP_011530846.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]