SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985823|ref|YP_605187.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985823|ref|YP_605187.1|
Domain Number 1 Region: 98-286
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 7.33e-28
Family MurCDEF 0.002
Further Details:      
 
Domain Number 2 Region: 292-404
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 4.58e-26
Family MurCDEF C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 18-92
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 0.0000000000000575
Family MurE/MurF N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985823|ref|YP_605187.1|
Sequence length 429
Comment UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase [Deinococcus geothermalis DSM 11300]
Sequence
MLDPHAPLPFTAHVHPEARSAKRLTWDSREASPEVAFVALPGEQMHGNRFVQAALAAGAP
FVLTDLDVPRAVRVPSQAGQGAREALFAWARAERAKNPLVVGITGSVGKTTAKSYAAAAL
NAHFMPVYNTMPAIACFLIEFGASGAPLVVEMGIDRVGEMAELVDLVRPDVGVVTAIGAA
HLEQLGSLEGVAREKGVILQGRRGLVGTQAAPWFPHTPTYGFGEGVTYAGEALTVSPQGA
QFTFQGVPVTLPLASRVQAEAAVLGLALALEAGLPLPEAAQRLAAVQVPGGRYRVHPGRF
TVIDDAYNASPLAVTAALDALATFGGRRISVLGRMLELGATERELHAQIGVHARQKADLT
YGVGAFAAELGERAYRTVPELLEDLLAEVRDGDVVLVKASRGISWTPEQRAQEGVGLDVV
VEALLRARG
Download sequence
Identical sequences Q1IXL6
WP_011530849.1.71355 319795.Dgeo_1723 gi|94985823|ref|YP_605187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]