SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985846|ref|YP_605210.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985846|ref|YP_605210.1|
Domain Number 1 Region: 36-421
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.53e-86
Family Amylase, catalytic domain 0.00000974
Further Details:      
 
Domain Number 2 Region: 817-994
Classification Level Classification E-value
Superfamily CBD9-like 0.0000000157
Family Family 9 carbohydrate-binding module, CBD9 0.017
Further Details:      
 
Domain Number 3 Region: 740-807
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000235
Family Carboxypeptidase regulatory domain 0.034
Further Details:      
 
Domain Number 4 Region: 546-623
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000054
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 446-524
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000417
Family alpha-Amylases, C-terminal beta-sheet domain 0.08
Further Details:      
 
Weak hits

Sequence:  gi|94985846|ref|YP_605210.1|
Domain Number - Region: 621-678
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0392
Family Anticodon-binding domain of Class II aaRS 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985846|ref|YP_605210.1|
Sequence length 1021
Comment alpha amylase [Deinococcus geothermalis DSM 11300]
Sequence
MKRFQKVGRSGALAVLTLALSACGVLKAPETGGNTRAWQDEVIYFAMTDRFANGNPANDN
GPNRNEGDRADRTNPLGWHGGDFAGLKAKIEEGYFKRMGFTALWISPVVLQVPAIEGPKT
GPNAGKLFAGYHGYWAEDFFKVDPHFGTLDEYKSLIQTAHRNGIKVIQDIVVNHAGYGAT
LTKTNPDWFHTQAECDASTNKRVDCPLAGLPDFKQERPEVTTYLNDFVNSWRKETGIDGL
RIDTMQHVPDSYWQQFFAAGGPGDPSKIWSVGEVFNGDPAFLAHYMDDLGSPSVFDFALY
FAIKDGLSSARGDLGRLADVFARDGAYRDPTRLTTFVDNHDVPRFVSEVQERGGTAAQAN
ERLDLALSLIYTSRGTPSVYQGTEIAQPGLGDPYNYATGQGNREDMNFGALSQSSIDERL
AALAAARAKYRALTHGVQQELWRPNGGAPIFAYRRIVTDGQGGQPVVVVINNGDTPVDLS
TLSGGGIPLLGTFSGTALTEITGRTSDLSVSGGQLVGTVPARSALAVTAPAGSGSTGTVN
PRLPEVTDLSAKAGDSAVQLTWTASTDLNVTGCRVYARTGSGQERLLNFAPLPKDQTTYL
AAGIPNDQETTFRVVTVDAQGAESRGVSVKATLSSKNTVRVTFTVDARSQGNGPIELRRF
DTGSQLEYPMTQVSRGIWKTAIDLPLFREIKFKFGNDGPAAKNSGYEAPGQPDRSYVVGT
NPNVYTGTYDFITQPVPQTTIEGQVRGAGNPLANALVEAVTANPDLHYAMTFPDGTYTLF
VPAGTHTLQAKAGGYVAASRQAISPGTGADFNLAQDLSTKYTIDGNLADWTAPKVTLQSP
TEGGFGPDNNWLTLQADSDDHYLYLAYTYRVKGNSAILYLDTKMGGAAQADNFEAWKRAA
TFSGSMGGADAFVARYENQMAQLRLVQSDTATPEVNTGDYKFAASGTLPEQTVELAIPWT
ALGLSEKPANGVNVVGGIFGGDGYGAGDIVPNTTSTPPGANTIGTDAEQRRATFTQPLNV
R
Download sequence
Identical sequences Q1IXJ3
319795.Dgeo_1746 WP_011530872.1.71355 gi|94985846|ref|YP_605210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]