SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985877|ref|YP_605241.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985877|ref|YP_605241.1|
Domain Number 1 Region: 73-410
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.01e-38
Family (Uracil-5-)-methyltransferase 0.0074
Further Details:      
 
Domain Number 2 Region: 6-61
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000166
Family TRAM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985877|ref|YP_605241.1|
Sequence length 410
Comment (uracil-5)-methyltransferase [Deinococcus geothermalis DSM 11300]
Sequence
MPDVLLTLEIEKLVAGGLGLARDGSGVVLVRGALPGERVEAEVRTGRGVRQGVTRTVLRA
SPDRVSAPDLPTLDLAHAAYPAQLVYKRGFVEEALARIAKLRHPVAPTLPSPHEWHYRNT
AQYLVTPRGLAYRERRGRDPLVVGRDPLVMAPIQAVMDRLDPERLNPATEVAFRASRLTG
EVVAALIGAGEPRHFLRASDHLLDAGVVGVSLAEPAGRRFGAGVRLIAGEAEIQEQFGQV
RVGITATGFAQVNPEAAGLAYIHAAELAGSGLHAVDLYGGSGAIGRHLAPHFARVTVLDT
AAEALVRGRQAVAVSGERNVSYRSGDAARLGELSTDVIVVDPPRAGLDEGARDHIHASTA
DRLVYVSCDPATWARDVGDLTRRGWRLGEVTPHDFYPQTSHVEVVSVLER
Download sequence
Identical sequences Q1IXG2
319795.Dgeo_1777 WP_011530903.1.71355 gi|94985877|ref|YP_605241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]