SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985901|ref|YP_605265.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985901|ref|YP_605265.1|
Domain Number 1 Region: 83-203
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.29e-35
Family PH0987 C-terminal domain-like 0.0000909
Further Details:      
 
Domain Number 2 Region: 6-86
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.000000000131
Family PH0987 N-terminal domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985901|ref|YP_605265.1|
Sequence length 205
Comment hypothetical protein Dgeo_1801 [Deinococcus geothermalis DSM 11300]
Sequence
MTGVEITPLGDAALEVRSARVRELLADLSARPLPGVWEAVPALDVLTVLYDPLAVEAEDL
AARLTARLADLCPQQAEEGQTHVLPVTFAGTDLAWCAAHAGLSVPDFVQALCSVTLTVAF
LGFTPGFAFLTGLPEGLQMPRLTTPRERVPAGSVALGGPWAGVYPRETPGGWRLVGRTEV
ALFDLQRPAPVLWQAGDRVRFEAGS
Download sequence
Identical sequences Q1IXD8
319795.Dgeo_1801 WP_011530926.1.71355 gi|94985901|ref|YP_605265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]