SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985940|ref|YP_605304.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985940|ref|YP_605304.1|
Domain Number 1 Region: 46-166
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 3.01e-39
Family Insert subdomain of RNA polymerase alpha subunit 0.00000528
Further Details:      
 
Domain Number 2 Region: 12-46,167-221
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 3.63e-29
Family RNA polymerase alpha subunit dimerisation domain 0.00022
Further Details:      
 
Domain Number 3 Region: 270-329
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.000000000000654
Family C-terminal domain of RNA polymerase alpha subunit 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985940|ref|YP_605304.1|
Sequence length 331
Comment DNA-directed RNA polymerase subunit alpha [Deinococcus geothermalis DSM 11300]
Sequence
MDQKRPQLKARVEGDYGEFVLEPLTRGYGVTIGNPIRRILMSSIPGTAVTSVYIEDVLHE
FSTIPGVKEDVIRIILNLKELVVKFHAPGPKTLTLRAQGEGVVKASAFEVPSDAEIVNPD
LTIATLAEDGKLVMEVRVEEGEGYVPADKHATKDRINSIPVDAVFSPVRRVAYHVENTRV
GQQTDLDRLILRIWTDGSVGPQEALDRAVEILRDELTVFGNVETVSAAAPELPSVYTPAA
PIVSGYDLPRQPELSINPQPYPADLDTPRVTLEGLGLTTRVLHSLKEEGIDSVDALCALS
DRDLKKVPGIGERSLDEIKQQLAQFGLALRD
Download sequence
Identical sequences Q1IX99
319795.Dgeo_1840 gi|94985940|ref|YP_605304.1| WP_011530965.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]