SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985971|ref|YP_605335.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985971|ref|YP_605335.1|
Domain Number 1 Region: 11-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.37e-106
Family G proteins 0.00000000471
Further Details:      
 
Domain Number 2 Region: 485-605
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-45
Family Translational machinery components 0.00000149
Further Details:      
 
Domain Number 3 Region: 609-695
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.83e-33
Family EF-G/eEF-2 domains III and V 0.0000282
Further Details:      
 
Domain Number 4 Region: 271-399
Classification Level Classification E-value
Superfamily Translation proteins 4.48e-33
Family Elongation factors 0.000026
Further Details:      
 
Domain Number 5 Region: 408-486
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.96e-25
Family EF-G/eEF-2 domains III and V 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985971|ref|YP_605335.1|
Sequence length 696
Comment elongation factor G [Deinococcus geothermalis DSM 11300]
Sequence
MTTKAQSYLTHFRNIGIAAHIDAGKTTTTERILYYTGRTHNIGEVHDGAATMDWMEQERE
RGITITAAATTAKWKRSGTNEEYTINIIDTPGHVDFTIEVERSMRVLDGAVAVFDSSQGV
EPQSETVWRQADRYGVPRIAFANKMDKTGASFELVVNDIRERLGAIPAPIQYPMGQENEF
KGIIDLVRQRAYTYTNDLGTEIQEHDVPAEYADKVAEMRAQLIEAAAEVDEDLMMMYLEG
EEPSVEQLVAALRKGTIDKKIFPVLCGSSLKNKGVQLLLDAVVDYLPSPLDIPAIKGTTE
NGEVIEYPADPEGKLAALAFKIMADPYVGRLTFVRIYSGTLQAGSYVYNASKDKRERVGR
LLKMHANSREEVTELKAGELGAVIGLKDAGTGNTLIGDGDTRVLLESIDVPEPVIKLAIE
PKTKADQEKMGIGLQKLAEEDPTFKVETDQESGQTTISGMGELHLEILVDRLKREYKVDA
NVGAPQVAYRETITKPVDVEGKFVRQSGGRGQFGHVKIKAEPLEPGAGFVFENAVVGGTV
PKEYIGPAQKGIEEAMQSGPMLGFPVVDMKVTLYDGSYHEVDSSEMAFKIAGSMALKEAV
QKGAPALLEPIMRVEVTVPEEYMGDIIGDLNSRRGQIQGMEARGNAQIVKAFVPLSEMFG
YATDMRSMTQGRASYSMFFDHYSQVPNNLAQQLMKK
Download sequence
Identical sequences Q1IX68
WP_011530994.1.71355 gi|94985971|ref|YP_605335.1| 319795.Dgeo_1871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]