SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986038|ref|YP_605402.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986038|ref|YP_605402.1|
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.09e-23
Family Thiamin pyrophosphokinase, catalytic domain 0.007
Further Details:      
 
Weak hits

Sequence:  gi|94986038|ref|YP_605402.1|
Domain Number - Region: 144-188
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00602
Family Thiamin pyrophosphokinase, substrate-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94986038|ref|YP_605402.1|
Sequence length 212
Comment thiamine pyrophosphokinase [Deinococcus geothermalis DSM 11300]
Sequence
MTAWILVGGRLVLTDALRALPRPDLVIAADGGGRHAAALGVDVDAWVGDFDSSDDLALNA
PREVHPRAKDETDAELAVLIARERGATDLVFLGAFGGRFDHAAALALGGVRLAREGLRVI
LHSGDESGYPLLPGADVGLDLPHGTTLSVLALSDLHGLTLEGTRWPLHKAGIPLGSGWTV
SNEAVGGPVHAALEKGLALVTVLWPAGTASRH
Download sequence
Identical sequences Q1IX01
319795.Dgeo_1939 gi|94986038|ref|YP_605402.1| WP_011531060.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]