SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986055|ref|YP_605419.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986055|ref|YP_605419.1|
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000327
Family Multidrug resistance efflux transporter EmrE 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94986055|ref|YP_605419.1|
Sequence length 111
Comment small multidrug resistance protein [Deinococcus geothermalis DSM 11300]
Sequence
MRAWIALFSAIACEVTGTLALKLLGLHTPWLALAVTGSLIVLSYLLLSLVFRRIPVAVAF
AVWEAVGLAAVTLLSVWLLGDHLTQLQLLALGGLLLGARLLHGGTRARGEA
Download sequence
Identical sequences Q1IWY4
WP_011531077.1.71355 gi|94986055|ref|YP_605419.1| 319795.Dgeo_1956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]