SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986158|ref|YP_605522.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986158|ref|YP_605522.1|
Domain Number 1 Region: 21-238
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 6.98e-88
Family Uracil-DNA glycosylase 0.000000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94986158|ref|YP_605522.1|
Sequence length 245
Comment uracil-DNA glycosylase [Deinococcus geothermalis DSM 11300]
Sequence
MSDPASLFGLPPDPDAAPPVHLPGDWDEVLRGETSQPYFRELWAFVQREREAGPVYPAPE
DLFSALRLTPYRDVKVLILGQDPYHGAGQAHGLSFSVRPGVRVPPSLQNIYKELRDDVGF
KPPRHGSLVSWARQGVLLLNAVLTVREGEPNSHAGKGWESFTDAIIRAVNEKPTRVVFVL
WGAYARKKAKLVTQPQHVIIESAHPSPLSVAKFLGTRPFSRINAALEAAGETPIDWQLPA
EPEVA
Download sequence
Identical sequences Q1IWN1
319795.Dgeo_2059 WP_011531179.1.71355 gi|94986158|ref|YP_605522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]