SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986164|ref|YP_605528.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986164|ref|YP_605528.1|
Domain Number 1 Region: 10-464
Classification Level Classification E-value
Superfamily L-aspartase-like 9.58e-137
Family L-aspartase/fumarase 0.00000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94986164|ref|YP_605528.1|
Sequence length 465
Comment argininosuccinate lyase [Deinococcus geothermalis DSM 11300]
Sequence
MTNTTQDKKLWGGRFAEATDGLVELFNASVAFDQRLAEQDIRGSLAHVAMLGQTGILTPD
EVAQIEEGLQGILADIRAGRFDWRLDREDVHMNVEAALRDRIGPVAGKLHTARSRNDQVA
VDFRLFTKEAALDLAAKVRALRAVLVAEAEKHLQDEVILPGYTHLQVAQPILLSHWLMAY
AAMLERDEGRFRDAAERMDESPLGSSALAGTPWPIDRFATAAALGFARPTANSLDGVGSR
DFALEFLSACAILAAHLSRLSEELILYSTFEFGFLTLPDSHTTGSSIMPQKKNPDVAELA
RGKAGRVFGNLMGLLTVVKGTPLAYNKDLQEDKEGVFDSYDTLSIVLRLYADMLPKTVWH
ADVTKLAAARGFSTATDLADFLARSGVPFREAHEVVGRLVGLASRTGRQLWDLTDEELRA
AHPLLSAEVARALTVEESVKSRRSYGGTAPERVREQVAAAKAALS
Download sequence
Identical sequences Q1IWM5
gi|94986164|ref|YP_605528.1| WP_011531185.1.71355 319795.Dgeo_2065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]