SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986191|ref|YP_605555.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986191|ref|YP_605555.1|
Domain Number 1 Region: 79-323
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.03e-37
Family Zn metallo-beta-lactamase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94986191|ref|YP_605555.1|
Sequence length 331
Comment metallo-beta-lactamase superfamily hydrolase-like protein [Deinococcus geothermalis DSM 11300]
Sequence
MSQKKPPTRKSPARAAAARKAPARAPAARAKPGKQNERRSGPTPSDLLGLLVLALTASLA
ACAFGGDKQGGDEKPGQPGGQVTIRFLDVGQGDAVLVRSPEGKTLLYDGGRSVSRMQEDL
RTYGIDKLDLMIASHADADHITGLIPAAEQAKPTLFINNGLAGTTRTWDRLVTALKDAGT
TFQKANNQVINLGSVKVRVIAPPAGMGSDQNDNSVGIRIDFGDFHALMTGDSETPETTAW
LAQDRAEVQGPFQVYKSIHHGAANGDNQAWLAVVRPENVVISVGENNYGHPTQKALDLYK
QNGIRIYRTDQQGTITFMGRGDGTYTVTTDR
Download sequence
Identical sequences Q1IWJ8
gi|94986191|ref|YP_605555.1| 319795.Dgeo_2092 WP_011531212.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]