SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986203|ref|YP_605567.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986203|ref|YP_605567.1|
Domain Number 1 Region: 285-585
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.13e-62
Family beta-glycanases 0.0024
Further Details:      
 
Domain Number 2 Region: 5-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.92e-43
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0054
Further Details:      
 
Domain Number 3 Region: 181-287
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000104
Family beta-Galactosidase/glucuronidase domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94986203|ref|YP_605567.1|
Sequence length 627
Comment glycoside hydrolase [Deinococcus geothermalis DSM 11300]
Sequence
MHDEHYPRPQLRRAHWRDLGGRWAFAYDDGARWQTPDEVHFDREIIVPFPPESAASGVGD
PASHPVVWYGTRVELTEDERPRPGERRLLLHFGAVDYRARVWVNGQLVAEHEGGHTPFSA
DVTALAGGPELRIVVRAEDDPHDLAQPRGKQDWKEQPHSIWYRRTTGIWQPVWLESVSQT
YLHELRWTPDLDREELRLQVRLNGAPPHPLQLRVRLSLRGRPLAQQTVALSGRQGSAVLP
LNHTPLNPERQDLLWSPRHPNLIDAEVALLSEDGAVVDEVRSYAGMRSVEVQGGRFLLNG
HPYYLRLVLAQNYWPESHLATPSPEALRREAELVKALGFNGVRIHQKIEDPRFLYWCDRL
GLLVWGEAANAYRFTDESCERLTREWLEALRRDYSHPCIVAWVPLNESWGVPNLERDPAQ
RAFVKGLYHLTRALDPTRPVVANDGWQHVAGDILGIHDYALEGAVLRERYGTPEAIERTF
AHVQPHFRNLLTAGHTRGEEAVMLTEFGGLSIRPGEGERWWGYGTVGTPEAFLEKYGDLV
GAVLDCESLAGFCYTQLTDTEQETNGLLTASRQPKFDLAAARAINTRPSRAVPGDVLNEI
HQAAQEEDRRRLAGSQEEPPVQPQHSG
Download sequence
Identical sequences Q1IWI6
319795.Dgeo_2104 WP_011531224.1.71355 gi|94986203|ref|YP_605567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]