SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986218|ref|YP_605582.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986218|ref|YP_605582.1|
Domain Number 1 Region: 48-473
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 2.88e-49
Family Outer membrane efflux proteins (OEP) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94986218|ref|YP_605582.1|
Sequence length 478
Comment outer membrane efflux protein [Deinococcus geothermalis DSM 11300]
Sequence
MRSPPVLLLLLALLTPGAAAQAVPPAVQGAPAPASPARLTLANVLTRLRAGPGWRAADLQ
YRQAALTLERARVQAGLNVTVGADVGAVKIPLSTGDLTLNTTVNAQASASVLPWSPALEA
VRSAERALASAAAELRATQQTLAVNAVQAYYAARNAAASLALADAQLALSQRQLAVAQAQ
RAAGVLTEEGLLARQDALADAQAAQRQARTNVDLAARGLANLLGQSVTLPADAEAFGPLP
PVPQSPSSAEALVTRALATRPEVARAQNDLADAQAQLRAAQRDARLPDLTASVQYGQLAA
TQAETGRVVGGSLNVKTGVLAGQVSLPLRDPGERPSGLALSLSGSFSVIGGGKGPALAAA
EVSVALAQAALESARQSVDLEVRQRSADLQTALDTLASQRGALARAQAALVSTQARLAAG
LATELDVQAAQLNVMQTQLAVDNATVQAHLASLRLGQATGELDPTLLILTPPAPEARP
Download sequence
Identical sequences Q1IWH1
gi|94986218|ref|YP_605582.1| 319795.Dgeo_2119 WP_011531238.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]