SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986232|ref|YP_605596.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986232|ref|YP_605596.1|
Domain Number 1 Region: 6-297
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.28e-57
Family DmpA-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94986232|ref|YP_605596.1|
Sequence length 301
Comment peptidase S58, DmpA [Deinococcus geothermalis DSM 11300]
Sequence
MQNLTLTAIPGFRVGHWTDSVGLTGCTVILCPDAGAVASASFLGPSPGTREGILLAPEKK
VERIHALLLTGGSAFGLAAAAGVVRVLEERGLGHATPWARVPLVPAAVIYDLGVGDPRAR
PGEREGELAARAASGDPVARGRVGAGTGATAGKYLGSGAVPGGLGSVCLERHGVRVGALA
VVNPIGDVLDESGNVLAGPGVGPGAAAFTPGELESTTLVAVATEHALTKTDARRLADAAQ
TALGRVIAPSHTFWDGDSTFVLSSCALPPADPLLLGALVQEAVCAAVRDAVRMANGLTPS
T
Download sequence
Identical sequences Q1IWF7
WP_011531252.1.71355 gi|94986232|ref|YP_605596.1| 319795.Dgeo_2133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]