SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986239|ref|YP_605603.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986239|ref|YP_605603.1|
Domain Number 1 Region: 76-259
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.32e-37
Family Biotin holoenzyme synthetase 0.0009
Further Details:      
 
Domain Number 2 Region: 265-309
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.000000279
Family Biotin repressor (BirA) 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|94986239|ref|YP_605603.1|
Domain Number - Region: 22-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00238
Family Biotin repressor-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94986239|ref|YP_605603.1|
Sequence length 324
Comment bifunctional biotin operon repressor/biotin--acetyl-CoA-carboxylase ligase BirA [Deinococcus geothermalis DSM 11300]
Sequence
MPSFSKSSTTLNVPARLLPLLTEVPQSGEILGARLGVGRVTVNTLARRLAEDGVPVVVTR
GGYALAPGTPAPQLVPVRGTFGQAMRYCGTVGSTQDEARVWADDPQAPAPHGAVVVAERQ
TAGRGRRGRSWDTTHGTLVLSVLLHGPLPLPELSLMPLAAGVALQAACGVGGLKWPNDLL
APDGRKLAGILLEADLRGEEARRAVLGIGVNVGAAPEGAACLCEFRPELTRAGLLACILA
ELERWLAAPPAAVLEAWRAANVTLGRDVRVSTPRGLLSGTALDLDPQGGLLIRTPEGTTV
TAHAGDVQLVGSLAPSHGPQEDTP
Download sequence
Identical sequences Q1IWF0
319795.Dgeo_2140 gi|94986239|ref|YP_605603.1| WP_011531259.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]