SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986300|ref|YP_605664.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986300|ref|YP_605664.1|
Domain Number 1 Region: 5-257
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.72e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000214
Further Details:      
 
Domain Number 2 Region: 260-450
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.28e-57
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000841
Further Details:      
 
Domain Number 3 Region: 565-726
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-44
Family AlaX-like 0.044
Further Details:      
 
Domain Number 4 Region: 464-563
Classification Level Classification E-value
Superfamily Translation proteins 3.21e-16
Family AlaX-M N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94986300|ref|YP_605664.1|
Sequence length 885
Comment alanyl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MTGPLTTAEIREKFLSFFESKGHLRLPSHSLIAPDPTTLFTVAGMQPFKPQFMGAPAKFP
GYGENRRVTTAQKCIRVGDIENVGRTRRHLSLFEMMGNFSFGDYFKREAILWAWEFLTSP
EWLGMDPARMYVTIYEDDNEAFGYWTQDVGLPEDHIHRFGADENFWPADAPAKGPNGPCG
PCSEIYYDRGPHYGDDTWADYAQTRESARFLEVWNLVFPQYDRQDGGVLADLPFKNIDTG
MGLERVASVVQDVPDFYSNDVFRPLVEKVAELSGKPYEGEVSVSHRVVAEHIRSVAMTIA
DGVALSNTGRGYVIRKILRRASRHAYLLGLHEPTLYRLVPLVVQAMGGAYPELVTEEARV
TAAIRAEEERFLKTLESGMQRLSGLLEGMERGAVLPGEEAFLLYDTYGFPLDLTKEIAEE
YGISVNEAEYAESLERAQETARAASKYGKSELFGGSQEALEGLPPTQFVGYDELEAQGEV
LALVGAGERLDHLMAGSEATVVLSRTPFYAEGGGEVGDTGVLEWEGGRGLVRDTRKTPAG
IWLHDVLVEEGELTPGVTVRGVVSSERQAIQRHHTATHLLHAALRAVLGPGVRQAGSLVA
PERLRFDFTHGAALTADELGQVERLVSRWVTANFPVTWREMPLAEAKAAGATALFGEKYG
DTVRVVRVEGGIPFGDATVTSMELCGGAHVTRTGDIGAFVIVSDENVAAGVRRIEALAGE
AATAWVRAQLNNVHRVSGLLNTSPDTLETRVIGLQSQLRAAQQETAQARRQLAEAQMGGA
STQQVRELGGFKVAVLRLSGIEGGELRGAADKLLDQSGADLAVIASDKGLVVKASKTAVA
RGAHAGQLIGKLAAAGGGKGGGRPDMAQAGIGNPEAALAALDTAF
Download sequence
Identical sequences Q1IW89
319795.Dgeo_2201 WP_011531318.1.71355 gi|94986300|ref|YP_605664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]