SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986310|ref|YP_605674.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986310|ref|YP_605674.1|
Domain Number 1 Region: 2-245
Classification Level Classification E-value
Superfamily CorA soluble domain-like 2.48e-47
Family CorA soluble domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 246-307
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 0.0000000000000222
Family Magnesium transport protein CorA, transmembrane region 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94986310|ref|YP_605674.1|
Sequence length 310
Comment Mg2+ transporter protein, CorA-like protein [Deinococcus geothermalis DSM 11300]
Sequence
MLTYYRSVGGKLQVVEGYTDGCWINATAPTAEELARVSRDTGLDLDYLSYPLDPDERSRF
EREDGQLLIIMQTSYRLGEDSDIPYDTVPLGILHTDHCLVTVCATENPVVNDVVSGLVRR
VSTAKKNRLTLQLFLRNAQRFLIDVRQINKQVERIEDRMETATRNKELMDLLKLEKSLVY
FITGLKANEAMMERVKRDRIFEMYEEDSDLLDDVLIENLQAIEMANIASNILTSMASAFA
SIINNNVNQVVKVLTVTTILVAIPTLVTSIFGMNVPLPFQENPEGMWIVLGIATLLSAVL
GLLFYRWRVF
Download sequence
Identical sequences Q1IW79
gi|94986310|ref|YP_605674.1| WP_011531326.1.71355 319795.Dgeo_2211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]