SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986361|ref|YP_605725.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986361|ref|YP_605725.1|
Domain Number 1 Region: 26-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-24
Family Extended AAA-ATPase domain 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|94986361|ref|YP_605725.1|
Domain Number - Region: 187-298
Classification Level Classification E-value
Superfamily Precorrin-8X methylmutase CbiC/CobH 0.0184
Family Precorrin-8X methylmutase CbiC/CobH 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94986361|ref|YP_605725.1|
Sequence length 316
Comment DNA polymerase III subunit [Deinococcus geothermalis DSM 11300]
Sequence
MSTSSPASSALLHGPLLEQTGVFRGNALLLTGPARVGKRDVAFAVAAQHNCSGTRGMYGE
ACGSCPSCRALAAGVHPDLLLVEPRATTTTGRAARRKVIPIGAILADRDKGREYETHVFE
FLELRPTFRRRVVVVDGAEHLGPEAANALLKLVEEPPHGALFVFLAEDLRAVIPTIVSRS
ARLSVTPAPDPAIERILALSGEVPDAELVAFAAGRAGVLADREAVRSALADAAEFTQALG
VSLLAALEAAERLEKRWDVTWHPEALRFAWRMRSSHARARADAALDALQAALEAYASPSL
SFQVFALNLREAFGEG
Download sequence
Identical sequences Q1IW28
gi|94986361|ref|YP_605725.1| 319795.Dgeo_2262 WP_011531377.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]