SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986437|ref|YP_605801.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|94986437|ref|YP_605801.1|
Domain Number - Region: 9-75
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00772
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94986437|ref|YP_605801.1|
Sequence length 77
Comment hypothetical protein Dgeo_2340 [Deinococcus geothermalis DSM 11300]
Sequence
MKPDLLRPLLGVLGLVIGFGLYALAERAPQPWPALLIGGLFVLLGISAWRYARGERWIQV
LGILLLVYGLLRMVLIR
Download sequence
Identical sequences Q1IVV2
WP_011531451.1.71355 319795.Dgeo_2340 gi|94986437|ref|YP_605801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]