SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984200|ref|YP_603564.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984200|ref|YP_603564.1|
Domain Number 1 Region: 202-332
Classification Level Classification E-value
Superfamily CBS-domain pair 2.81e-25
Family CBS-domain pair 0.0029
Further Details:      
 
Domain Number 2 Region: 341-424
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-20
Family CorC/HlyC domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984200|ref|YP_603564.1|
Sequence length 435
Comment hypothetical protein Dgeo_0092 [Deinococcus geothermalis DSM 11300]
Sequence
MGNPWLEFGILILLLIINGFFSGSELGVVSAKRSRLEAAAARGSRGAAAAVRLTEQPGAF
LATVQIGITLIGTISAVFAGGSLTGYLEPLLRPLFGAAAGSAANVAVVLLVTFLSLVLGE
LAPKGIALRNPEALAARVAPFFTVLSRVARPLVWLLDRTASGLLWLLGMRGAAQEVVTEE
DVRAVVLQAAESGSLEETESERIASVLRFNDRRVRDLMTPRTEAVTLDLDAPIEKLVETV
LENEHDRYAVRDGRGDVVGQVAVTDVLRALYTGEPLADFVRPAVFVPEAAWAEDALARLE
REGQQRLAVVVDEYGDFSGVLSISDLLAELAGVEDQGDEDRIVRREDGSFLVDGGIAMHE
LRETLPLPALPREEFSTLAGYVLDVLGEFPQVGAVATVDGWDIEVVDVDGPRVDRLLIRP
PRNVGNVGRVADAEA
Download sequence
Identical sequences Q1J289
319795.Dgeo_0092 gi|94984200|ref|YP_603564.1| WP_011529242.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]