SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985040|ref|YP_604404.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985040|ref|YP_604404.1|
Domain Number 1 Region: 114-419
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.95e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily tRNA-binding arm 6.28e-29
Family Seryl-tRNA synthetase (SerRS) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985040|ref|YP_604404.1|
Sequence length 437
Comment seryl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MLDLKFIREHPGTVKHAIAVKGVNLDLDELLRIDRELVELRQRVEALQTERNANAKLVPK
ATPEERPHLIQKGKDLAEDIKALEPQLRAHEDQLRQLLLRVPNIPHPSVPVGQDDSENVE
LRREGQLPEFAFPPLDHVELLERQGWSDPERVARVSGSRSYLLKGDAVLLEMAVLMFALD
FLRGRGLTPLSTTALVRPETLVGSGHFPGGEDQVYKIEGDELMLAGTAEVPVNSLYAGEQ
LSYEELPLAFAAISAAFRSEAGSAGRDVRGLIRVHEFRKVEQYVMTRADEAEALRWFGAI
LENAEGLLRALELPYRVVQNCTGDMGAGKVLMYDIETWVPSEGKYRETHSCSYLGDWQAR
RTGLRYRDEHGKLVYAHTLNNTGIATPRILVPLLENHQQADGTIRVPEALRPYLGGREVL
GVPVRAAAAEAKSPRNK
Download sequence
Identical sequences Q1IZU9
319795.Dgeo_0934 WP_011530072.1.71355 gi|94985040|ref|YP_604404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]