SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985501|ref|YP_604865.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985501|ref|YP_604865.1|
Domain Number 1 Region: 257-439
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 6.23e-69
Family MgsA/YrvN C-terminal domain-like 0.00000367
Further Details:      
 
Domain Number 2 Region: 28-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.57e-47
Family Extended AAA-ATPase domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985501|ref|YP_604865.1|
Sequence length 451
Comment recombination factor protein RarA [Deinococcus geothermalis DSM 11300]
Sequence
MCKMLIRASLPGLPPAILPPVTLFDPPAPLPERLRPRTLAEVVGQGHLLGPGRPLTRLLQ
GGRLGSLIFWGPPGVGKTTLARLIASEVGAHFIPLSAVSAGVKDVREAVMEAERLRARGQ
PTILFLDEIHRFNKAQQDALLPHVESGLLTLIGATTENPSFEVNPALRSRARTLVLEPLS
QEDVRGLLERALADPRGLPGVAAQPEALDLLARLADGDARRALGTLEVAATLANPVTSEA
VREAFGRHLPAMDKNGEDFYNLISALHKSVRGSHVNASLYWLARLLEGGADPLYVARRIM
RMASEDIGLADPQALRLCVAARDAMEFLGSPEGELALAQAVVYLALAPKSNSVYVAWKKA
RDAVREGEMLPVPLHLRNAPTALMREQGYGQGYAYYFDDPQGSFEQDYLPGGVRLGLYAP
TGEGWEARVEGRWRKLREAHGEGTDMAAPET
Download sequence
Identical sequences Q1IYI8
WP_011530532.1.71355 gi|94985501|ref|YP_604865.1| 319795.Dgeo_1401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]