SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985637|ref|YP_605001.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985637|ref|YP_605001.1|
Domain Number 1 Region: 312-591
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 6.54e-74
Family DNA repair protein MutS, domain III 0.000000154
Further Details:      
 
Domain Number 2 Region: 594-821
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-55
Family ABC transporter ATPase domain-like 0.000000366
Further Details:      
 
Domain Number 3 Region: 41-146
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.79e-33
Family DNA repair protein MutS, domain I 0.00000757
Further Details:      
 
Domain Number 4 Region: 155-306
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 5.89e-24
Family DNA repair protein MutS, domain II 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985637|ref|YP_605001.1|
Sequence length 880
Comment DNA mismatch repair protein MutS [Deinococcus geothermalis DSM 11300]
Sequence
MSLLSQLQPPFRPQQNGVRYAPPMPVGVPQNVLKGTGSGVLPPMLEQYVALRDAHPDFLL
LFQVGDFYETFGEDAERLSRLLGIALTHKSSKDFSTPMAGVPLRTLDSNVERLLAAGVRV
AVADQVEEPGSGLVERKVTQLLTPGTVTEERHLTADENYLGAVATGDGYALALLDVSTGE
FRCAAFHTRTALYDELARHRAREVLLAPELSGNAALLADFQARFPVMLSPANFDEENARQ
ELEAVLGEVPGSLGSAALVRACGAVLGYARLTQQGRLEMVRRVVRFEPGAHMRLSDAAVR
ALEVFTPQSPQGMTLMDVLNETRTAGGRRRLRAWLRAPLLDELSIRARLDAVETLTRAPD
LRGAVRALLYRAHDLERLSARVATRRASPREVASLARTLELLPEAMNLLGDQDGLLAGIR
ARLGALPDVVTLIRAALVDDPPLRVGEGGLIRDGFHAELDGLRSEALGHRAWLAELEASE
RARTGISSLKVGFNNVFGYYLEVSGPNLSKVPADYRQIATLKDRARFTRPDLREREREIA
RLEAAAGRLELEVFTELRDGLSAHAEALAEAAGALAELDVLAALAEIAVNWGWVRPQTVA
GHARLVQARHPVVERATGGRFVPNDAELGPHRHTLLLTGPNMAGKSTYLRTVALCALLHQ
IGAFVPADHAELPIYDAIHTRIGASDDLAGGRSTFMVEMSELAAILHGVTHRSLVILDEV
GRGTSTLDGLAIAQAALEHLHAAGAHTLFATHYFELTRLEADLPGLVNLHVAAEEDEGSG
LTFYHQVIPGAARQSYGVEVARLAGLPAPVTSRAARLLTALNAGGDDRKLLRELAALDLG
RLTPLQALEVLHRWQAEARGSFSPEDRGPSAESAAAGEHA
Download sequence
Identical sequences Q1IY52
319795.Dgeo_1537 gi|94985637|ref|YP_605001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]