SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985709|ref|YP_605073.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985709|ref|YP_605073.1|
Domain Number 1 Region: 333-567
Classification Level Classification E-value
Superfamily PHP domain-like 7.85e-40
Family PHP domain 0.0029
Further Details:      
 
Domain Number 2 Region: 175-306
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000000000563
Family DNA polymerase beta-like 0.0048
Further Details:      
 
Domain Number 3 Region: 4-83
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0000000000101
Family DNA polymerase beta, N-terminal domain-like 0.0056
Further Details:      
 
Domain Number 4 Region: 80-146
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000034
Family Achaeal helicase C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985709|ref|YP_605073.1|
Sequence length 572
Comment PHP-like protein [Deinococcus geothermalis DSM 11300]
Sequence
MPDVTRKQLVGVLNTTADLLDVLGQEPFRASAYRGAARSLEATGTPVADLVATGFAGIPK
VGKAIAADLAAFVTTGTFAPLEEAASQVAPGVLGLFRVRGLGPKKIRALWDAGIDSLEVL
REAARDGRVAALKGFGAKSAATILEAVEFVLSTQDRQHLSTGLDVSDTLAAWLDGLEPRL
AGDARRGLETVRTVRVTVTGSAEDVTARLAERVEALARLDPKPLLTGRVDGVPVEIAYAP
AEARGALDLMMGGSTEYRASLRAEARAQGFDLSGRGLKRAGQLLPTPAEADVTRALGCPL
RPAEYREPEHDEVWETLPPPAELVTVADLRGLLHTHSVWSDGAATLLEMVETAARLGSPA
GGTYLGTGDHSRAAHYANGMSIERLRAYVREIRELQRSGLPLLAGAEVDILEDGSLDYPD
EELLSLDYVVASVHSHFTLDAGRQTERLVRAVSHPLVTILGHPTGRLLLRRPGYALDLDA
VLAAASANGTVVEINANPARLDLDWRYALRWRDRLTFAINTDAHVPAGLGDTRYGVAVAR
KAGLTPAQVVNTLSQEEFLAFVRRQREARTRG
Download sequence
Identical sequences Q1IXY0
WP_011530738.1.71355 gi|94985709|ref|YP_605073.1| 319795.Dgeo_1609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]