SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94986015|ref|YP_605379.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986015|ref|YP_605379.1|
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 4.8e-28
Family PaaD-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94986015|ref|YP_605379.1|
Sequence length 171
Comment phenylacetate-CoA oxygenase subunit PaaJ [Deinococcus geothermalis DSM 11300]
Sequence
MPRSGKPLTAVHVTPEQVWATLAAVPDPEIPVVSVTDMGMVRDVTVDGGRVTVTFTPTFS
GCPALHVIRDSIGKAVRALGVEDVEVRSTLTPPWTTDWIKADARERLRQYGIAPPAPAGD
TPLITLDPEPTRCPRCGSLNVRMTASFGPTLCKRLYVCESCREPFEGFKSV
Download sequence
Identical sequences Q1IX24
319795.Dgeo_1915 gi|94986015|ref|YP_605379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]