SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94986436|ref|YP_605800.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94986436|ref|YP_605800.1|
Domain Number 1 Region: 17-220
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-73
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000168
Further Details:      
 
Domain Number 2 Region: 204-339
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.18e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94986436|ref|YP_605800.1|
Sequence length 340
Comment transketolase, central region [Deinococcus geothermalis DSM 11300]
Sequence
MTATQSKPPSTSSAGETRTLTLIQAINEAMQEELARDERVVVFGEDVGARGGVFLATAGL
QEQFGKKRVFDTPLSEASIVGAAVGMAVRGLRPIAEIQFADYMGPGFDQIISQAAKIRYR
SGGQFTAPLVIRTPSGGGVKGGHHHSQSPESYFTHTPGLKVVMPSTPYDAKGLLKSAVRG
GDPVIYFEPKRLYRAAKGEVPTQDYTVELGKGAVRREGSDLTIIGYGGVMPDAEKAAQAL
ATEGVQAEVIDLRSLVPWDRDLVLTSVAKTGRAVLVSEAPRISNFMGEVAYVIQEQLFDQ
LLAPVMQVAGFDTPYPYVQDKVYLPGANRIAAACVRALNY
Download sequence
Identical sequences Q1IVV3
WP_011531450.1.71355 319795.Dgeo_2339 gi|94986436|ref|YP_605800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]