SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014248 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014248
Domain Number 1 Region: 254-533
Classification Level Classification E-value
Superfamily SPOC domain-like 3.73e-86
Family Ku70 subunit middle domain 0.000000000653
Further Details:      
 
Domain Number 2 Region: 34-253
Classification Level Classification E-value
Superfamily vWA-like 8.34e-61
Family Ku70 subunit N-terminal domain 0.00000000751
Further Details:      
 
Domain Number 3 Region: 560-608
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000513
Family SAP domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014248   Gene: ENSDNOG00000018356   Transcript: ENSDNOT00000018355
Sequence length 609
Comment pep:known_by_projection scaffold:Dasnov3.0:JH583493.1:260606:291111:-1 gene:ENSDNOG00000018356 transcript:ENSDNOT00000018355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGWESYYKNEGDDDDDEGQDEGADAGGEYKYSGRDSLIFLVDASKTMFESQDEDELTPF
DMSIQCILSVYTNKIISSDRDLLAVVFYGTEKDKNSVNFKNVYVLQELDNPGAKRVLELD
QFKGQQGEEHFRDLIGHGSDYSLSEALWVCANLFSDVQFKMSHKRIMLFTNEDDPHGNDS
AKASRARTKASDLRDTGIFLDLMHLRKRGGFDISVFYRDIISVAEDKDIGVHFEESSKLE
DLLRKVRAKETRKRTLCRLKLKLSKDIALTVGIYNLVQKAFKPPPVRLYRETNEPVKTKT
RTFNVNTGSLLLPSDTKRSQVYGSRQIVLEKEETEQLKRFDEPGLILIGFKPLIMLKKHH
YLRPSLFVYPEESLVNGSTTLFSALLTKCLEKEVMAVCRYIPRQNTPPYFVALVPQEEEL
DDQKIQVTPPGFQLVFLPYADDKRKVPFTEKVTANPEQVDKMKAIVQKLRFKYTSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKAEKMNKRLGSLVDEFKELVYPPNYNPEGKV
TKRKQDDEGSGSKKPKVEFSQEDLKAHISKGTLGKLTVPMLKEACRVCGLKGGLKKQELL
DVLTKHFQK
Download sequence
Identical sequences ENSDNOP00000014248 XP_004484200.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]