SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023579 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023579
Domain Number 1 Region: 56-139
Classification Level Classification E-value
Superfamily dUTPase-like 7.98e-23
Family dUTPase-like 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023579   Gene: ENSDNOG00000047136   Transcript: ENSDNOT00000031460
Sequence length 140
Comment pep:novel scaffold:Dasnov3.0:JH571128.1:1541939:1542361:1 gene:ENSDNOG00000047136 transcript:ENSDNOT00000031460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTTMPCSEETPAVSPPSSPACGEGGESTHFAQLWSCPRRRPRGPSCGYTGPPVEKALPSG
CYGRAAPRSGWAAKHFLDVGAGVTDEDYRANVGVVLFNFGKEKFEVKKSARIAQLICERI
FKSEIQEVQGSGDFGSTGKN
Download sequence
Identical sequences ENSDNOP00000023579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]