SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000026862 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000026862
Domain Number 1 Region: 43-153
Classification Level Classification E-value
Superfamily dUTPase-like 8.37e-22
Family dUTPase-like 0.00000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000026862   Gene: ENSDNOG00000048292   Transcript: ENSDNOT00000048987
Sequence length 154
Comment pep:novel scaffold:Dasnov3.0:JH569164.1:448901:449391:-1 gene:ENSDNOG00000048292 transcript:ENSDNOT00000048987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTGFSPLFSSGSRSLQAMPCSGVCIRFAPLWEHATARPTGARRQWADLYSVHDYPVPAM
EKALVKTQLALPPGCYGRVAPHSGMAAKHFLDVRAGVTDEDYRGNVSAVLFNFGKEKFEV
KKVLEYFFYPEIEEVQGLDVVKRNSGGSGSTGKN
Download sequence
Identical sequences ENSDNOP00000026862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]