SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000028455 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000028455
Domain Number 1 Region: 245-542
Classification Level Classification E-value
Superfamily SPOC domain-like 8.24e-95
Family Ku80 subunit middle domain 0.000000000329
Further Details:      
 
Domain Number 2 Region: 6-240
Classification Level Classification E-value
Superfamily vWA-like 5.66e-52
Family Ku80 subunit N-terminal domain 0.0000000179
Further Details:      
 
Domain Number 3 Region: 560-710
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 8.76e-47
Family C-terminal domain of Ku80 0.000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000028455   Gene: ENSDNOG00000017606   Transcript: ENSDNOT00000049416
Sequence length 732
Comment pep:known_by_projection scaffold:Dasnov3.0:JH577728.1:198409:295065:-1 gene:ENSDNOG00000017606 transcript:ENSDNOT00000049416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSGNKAAVVLCMDVGFAMSNSFPGEESPFEQAKKVMTMFVQQQVFAESKDEIALVLFG
TDGTDNALASEDQYQNITVHRHLKLPDFDLLLDIKSTIQPGSQQADFLDALIVCMDVIQQ
ETIGKKFEKRHIEVFTDLSSPFSKDQLDIIIYNLKKSGISLQFFLPFQIGKEDGTGDRGD
SNLHLDQHGSSSPQKGITEQQKEGIQMVKKVMMSLEGEDGLDEIYSFSESLQQLVVFKKI
SKCSLPWSCQLTIGSNLSIKISAYKSILQEKLRKTWSVVDARTLKKEDIQKETVYCLNDD
DETEVPKEDTIQGYRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCRSSQVQRKFFMGNQ
VLKVFAAKDDEAAAVALSALIHALDQLDMVAIVRYAYDKRANPQVGVAFPYIKDTYECLV
YVQLPFMEDLRQYMFSSLKNNKKFTPTEAQLSAVDDLIDSMSLIKKNEEENTIEDLFAVT
KIPNPQFQRLFQCLLHRVLHSQEPLPPIQQHILNMLNPPTEVTTRCQIPLSKIKTLFPLT
DAIKKKDQMTAQDIFQDKNEDGPTSKKYKTEEGEVRFSISSLAEGSVTSVGSVNPAENFH
VLVRQKNANFEEVSHQLISHIEQFLETNETPYFMKSMDCIRAFREEAIQFSEEQRFNNFL
KALREKVEMKQLNHFWEIVIQDGITLITKDEASGSTVTAEEAQKFLAPKEKPDEDAARVE
EGGDVDDLVSTP
Download sequence
Identical sequences ENSDNOP00000028455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]