SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000003549 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000003549
Domain Number 1 Region: 151-281
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.75e-35
Family Insect phospholipase A2 0.00037
Further Details:      
 
Domain Number 2 Region: 365-469
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 5.09e-16
Family Insect phospholipase A2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000003549   Gene: ENSDNOG00000004597   Transcript: ENSDNOT00000004596
Sequence length 516
Comment pep:known_by_projection scaffold:Dasnov3.0:JH563241.1:596547:601508:1 gene:ENSDNOG00000004597 transcript:ENSDNOT00000004596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLTELLGVLGFLGAALGGSPAFRWDSTSCHLALPTAGGPLSSLSFLGQAAQGLALFHA
LWDGHGGLQACTWQDEPELTAAFGALCAHEITRGSFTHTPGPELQRALTTLQSQGEACRG
PAESTAGAREKRAAGKDGAPGGGHRRVKRGWTMPGTLWCGFGDSAGNSSELGIFQGPDLC
CREHDLCPQNISPFQYSYGIRNFRFHTISHCDCDVRFQQCLRDQRDSISDLVGVAFFNVV
EVPCFVLEEQEACVAWYWWGGCRTYGSVPLARLQPRILYNATWRPPTTPGAPTSQSLAPT
GPRRKQHSRKRPRQREGPELPSKAKATALPAPEASPRLVVAPTAQPEVPHPGLQGPQKSQ
APPGAHRACRSFRRLDQCEHQIRPQETKFHLLNSAHETLFHCNCTRRLARFWRLRGPPAG
AESLGELLGVSCFKLAPPLACAEAESCPSDLRAIRVSARHLRRLWRRRPQLRATVPDERQ
AWPLEPPGVPMSFYDRCLQLTQAARKPGGPQKSWSP
Download sequence
Identical sequences ENSDNOP00000003549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]