SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004373 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000004373
Domain Number 1 Region: 647-783
Classification Level Classification E-value
Superfamily EF-hand 0.00000000177
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 477-530,567-691
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000487
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004373   Gene: ENSDNOG00000005635   Transcript: ENSDNOT00000005640
Sequence length 973
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569075.1:107574:184510:-1 gene:ENSDNOG00000005635 transcript:ENSDNOT00000005640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSSRVQPQQPGDATRPPASRAAGPGLRMAGSAALGAGLAAAGGLREQRGLEIEMERIR
QAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEEDDEEEDEEVEGEEGGMVVEMD
VEWRPGSRRSAASSAVSSAGTGGRGLGGYHGAGHPSGRRRRLEDQGPSCPSPAGGGDPLH
RHLPLDGQPPRVAWAQRLVRGLRGLWGTRFMEESNTSREKYLKSVLRELVTYLLFLIVLC
ILTYGMMSSSMYYYTRIMSQLFIDTPVSKMEKTNFKTLSSVEDFWKFAEGALLDGLYWKT
EPSNRTEADNRSFIYYENLLLGVPRIRQLKVRNGSCSIPQDLRDEIKECYDVYSVSSEDR
SPFGPRNGTAWTYTSEKDLNGSSHWGMIATYSGAGYYLDLSRTREETAAQVANLKKNVWL
DRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPVKLIRYVTTFDFFLAA
CEIIFCFFILYYVVEEILEIRIHKLHYFRNFWNCLDVVIIVLSVVAIGINIYRASNMEVL
LRFLEDQNTFPNFEHLSYWQIQFNNVAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAK
DLLGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRV
LGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIKKGYHKALIKL
KLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEH
QQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVS
YEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMEQAKLKRREVLGRLLDGVAEDERLG
RDSEIHREQMERLVREELERWESDDAASQISHGVGMPVGLNGHPRPRSSRPSSSQSAESI
EGGGGNGSSNIHV
Download sequence
Identical sequences XP_004463979.1.11602 ENSDNOP00000004373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]