SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004460 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000004460
Domain Number 1 Region: 2-156,192-563
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.19e-81
Family Acetyl-CoA synthetase-like 0.0000444
Further Details:      
 
Domain Number 2 Region: 754-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-42
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 
Domain Number 3 Region: 553-608
Classification Level Classification E-value
Superfamily ACP-like 0.0000393
Family Acyl-carrier protein (ACP) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004460   Gene: ENSDNOG00000005760   Transcript: ENSDNOT00000005761
Sequence length 1101
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568349.1:482245:519194:1 gene:ENSDNOG00000005760 transcript:ENSDNOT00000005761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHQTASLHLDKIAVCFDECNNQSPVYYTYKTVINAASELSNFLLLHCDFQGIWE
IGLYCHPGINVISWILGILQVPAAYAPIDPDSSPALSTYFMKKCNLKYILVEKKLVDKFK
SSHETLNYSTFIVEHNDLVLFTLHWKNVQMTLMPSDRREKYEKEKMENTMGSGSSNEEKS
EECMDVRLKCCLAYVLHTSGTTGVPKIVRVPHACIVPNIQHFRILFEITQEDVLFLASPL
TFDPSVVEIFVALSSGASLLIVPTSVKMLPSKLAAVLFSDHRVTVLQATPTLLRRFGSEL
IKSTVLSSSTSLRILALGGEAFPSLTVFRSWRGEGNKTKIFNIYGITEVSSWATFYRIPE
KILNSALKSELPVQLGFPLLGTIVEVRDTNGFTVQEGNGQVFLGGRNRVCFLDDEMTVSL
GTLRATGDFVTVKDGEMFFLGRKDNQIKRHGKRLNIEHVQQVAEGLQQVESCAVIWHNQE
KLILFVVSKEELVKDFIFKELQKYLPRHAIPDELVLIHTLPFTSHGKIDVSELNKIYLDY
INLKSHSKLSGKEELWEKLQHLWKSILSLSEDHLKIPKESLFLNSGGDSLKSIRLLNEIE
NLIGTSVPGLLEIILSSSILEIYNHILQMVFPDEDLLLSKSYATKRKFSDISQGETSEKS
LYHKSGMPLNYDIEINACTALSRGNQILSLNATRFLTKLEHCPLACSSSLISPANIQNVK
NSNPATLIGKSEELSCIAEDSEEEKPNVGAEKLELRVRWSSDTGKCVDASPLVIIPAVDK
SFATVYIGSHSHRIKAVDLYSGKVKWEQILGDRIESSACISNCGNFIIVGCYNGLVYVLK
SNSGEKHWMFATQDAVKSSATMDPSTGLLYIGSHDQHAYALDIYYNKKQIQISFCLLYTL
FSTMGMYYFYYKHLYFATLGGLLLAINPTTGNRIWKYSCGKPLFSSPRCCLQYICIGCVD
GNLLCFTHFGEQVWKFSTSGPIFSSPCTSASEEEIFFGSHDCFIYCCNMKGHLQWKFEAT
SRVYATPFAFRNFVCSNEMLLAAASTDGKLWILESKSGQLQSVFELPGEVFSSPVVWESM
LVIGCRNNYVYCLDLLESNQK
Download sequence
Identical sequences ENSDNOP00000004460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]