SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007072 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007072
Domain Number 1 Region: 124-384
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000752
Family Tropomyosin 0.0028
Further Details:      
 
Domain Number 2 Region: 321-566
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000412
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007072   Gene: ENSDNOG00000009129   Transcript: ENSDNOT00000009137
Sequence length 627
Comment pep:known_by_projection scaffold:Dasnov3.0:JH573283.1:112050:231617:1 gene:ENSDNOG00000009129 transcript:ENSDNOT00000009137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRSRSKSPRRPSPSSRGANCDVELLKTTRDREELKCMLEKYERHLAEIQGNVKVLTSER
DKTFLLYEQAQEEIARLRREMMKNCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDS
LRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETITTVEKEMKS
LARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEK
IDNFTRQSIAQREEISILGATLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGM
KNIIAEMEQASRQSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQF
SKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQIMDQLRKAN
EDAENWENKARQAEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQMENELDSARSEIE
LLRSQMTNERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSR
DVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHLNTTIKPNTKCH
SPERTHHRSPDRGLDRSLEENLCYRDF
Download sequence
Identical sequences ENSDNOP00000007072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]