SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007395 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007395
Domain Number 1 Region: 640-895
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 28-288
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-54
Family YWTD domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 339-570
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-51
Family YWTD domain 0.00000299
Further Details:      
 
Domain Number 4 Region: 942-1199
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-37
Family YWTD domain 0.0000913
Further Details:      
 
Domain Number 5 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1292-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1252-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 8 Region: 595-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000576
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 898-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000002
Family EGF-type module 0.028
Further Details:      
 
Domain Number 10 Region: 293-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1209-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007395   Gene: ENSDNOG00000009528   Transcript: ENSDNOT00000009539
Sequence length 1610
Comment pep:known_by_projection scaffold:Dasnov3.0:JH580715.1:38322:133568:1 gene:ENSDNOG00000009528 transcript:ENSDNOT00000009539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDGGLPGRPVPGAASGPHALPSAPTASPLLLFANRRDVRLVDAGGAKLESTIVVSGLEDA
AAVDFQFSRGAVYWTDVSEEAIKQTYLNRTGAAVQDVLVSGLVSPDGLACDWVGKKLYWT
DSETNRLEVANLDGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGST
RKIVVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTL
SGDTLYWTDWQTRSIHACNKRTGEKRKEVLGALYSPMDIQVLSQERQPYLHTQCEEDNGG
CSHLCLLSPREPFYACACPTGVQLQGDGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDI
VLPVDDVRHAIAIDYDPLEGHVYWTDDEARAIRRARLDGSGAQTLVSTEVHDPDGIAVDW
VARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVVHPVMGLMYWTDWGENPKIE
CAHLDGQARHVLVNTSLGWPNGLALDLPEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKL
PHIFGFTLLGDFIYWTDWQRRSIERVHKVQASRDVIVDQLPDLMGLKAVNVARAVGTNPC
AEGNGGCSHLCFFTPRATRCGCPIGLELLSDRRTCIVPEAFLVFTSRAAIHRISLETSNN
DVAIPLTGVKEASALDFDASNNHIYWTDVSLKTISRAFMNGSSVEPVIEFGLDYPEGVAV
DWMGRNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTRGYIYWTEWGGKPR
IVRAFMDGTSCMTLVDKVGRANDLTIDYASQRLYWTDLDTNMIESSNMLGQERVVIADDL
PHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLND
CVHNNGQCGQLCLAVPGGHRCGCAAHYTLDPSSRNCSPPTTFLLFSQKCAISRVIPDDQH
SPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPSVLTSPGQGQNPDRQ
PHDLSLDIYSRTLFWTCEATNTINVHRLSGEAMGAVLCGDRDRPRAIVVNAERGYLYFTN
MQERAAKIERTALDGTEREVLFSTGLVRPVALVVDNALGKLFWADADLKRIESCDLSGAN
RLTLEDDNIVQPVGLTVLGSHLYWVDRQQQMVERMEKTTGYQRTRVQGRIAHLTGLHAVE
GVSPEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFA
CATGEIDCIPGAWRCDGFPECDDRSDEEGCPVCSAAQFPCGHGQCVDLRLRCDGEADCQD
RSDEADCDTVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSS
AIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGASGPFPHEYVSGTPHVPLNFIAPGGSQH
GPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPA
TDPSLYNVEMFYPSSIPAATRPYRPYIIRGMVPPTTPCSTDVCDSDYSASRWKASKYYLD
LNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSDNOP00000007395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]