SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009305 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009305
Domain Number 1 Region: 643-900
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-55
Family YWTD domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 33-291
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-55
Family YWTD domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 342-581
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-49
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 4 Region: 948-1207
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 902-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000181
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 598-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.008
Further Details:      
 
Domain Number 7 Region: 1261-1300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1339-1375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 1301-1337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 294-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1217-1270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000163
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009305   Gene: ENSDNOG00000011984   Transcript: ENSDNOT00000011995
Sequence length 1631
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569988.1:1424182:1586313:-1 gene:ENSDNOG00000011984 transcript:ENSDNOT00000011995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRRSRVRCPGPPDSPILLMCIHSSLLFIVLAAPLLLYANRRDLRLVDANGKENATIVVGG
LEDAAAVDFVFGHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKL
YWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMD
GSSRFIIINTEIYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFA
LTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGID
NGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDF
TDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSLIDGSSSQFVVTAQIAHPDGIA
VDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMIGYMYWTDWGEIP
KIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVE
DKIPHIFGFTLLGDFVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVRRIIGS
NPCAEENGGCSHLCLYRPQGLRCACPIGFELINDMKTCIVPEAFLLFSRRADIRRISLET
NNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEG
MAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGG
KPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLEIGLNREV
IADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQ
AGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNNDNRTCSAPTTFLLFSQKSAINRM
VIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSV
PNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPE
KGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIE
SSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQ
LSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEEP
PTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGVLR
CNGDANCQDKSDEKNCEVLCLIDQFRCANGQCVGKHKKCDHNVDCSDKSDEVDCFRNKNP
TEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVP
LGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFP
AILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYA
PSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLY
PPPPSPCTDSS
Download sequence
Identical sequences ENSDNOP00000009305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]