SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009992 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009992
Domain Number 1 Region: 128-586
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.03e-117
Family Pyridoxal-dependent decarboxylase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009992   Gene: ENSDNOG00000012871   Transcript: ENSDNOT00000012880
Sequence length 587
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569826.1:170108:209531:-1 gene:ENSDNOG00000012871 transcript:ENSDNOT00000012880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLRAAEALPCARTTLSALGRAPTCQARPPAVSPTARSPLQAPAHRANPAAAAAPAGTED
GTGKPCQMTPEGSKMYFVCGRTMSLLGPEGMCSESKSLWYLQWPPKAAEALLQDVFGIVV
DEAIRKGTSASEKVCEWKEPEELKQLLDLELRSQGESQERIVERCREVIRYSVKTCHPRF
FNQLFSGLDPHALAGRIITETLNTSQESLLHFFPLVSFGPPFSKLSHAFRPPIFFSSHHP
LPVTGGSISNMYAMNLARYQRYPDCKQRGLRALPPLALFTSKECHYSIMKGAAFLGLGTD
SVRVVKADERGKMIPEDLERQISLAQAEGAVPFLVSATSGTTVLGAFDPLEAVADVCQRH
GLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLTAGLQCSALLLRDTSNLLK
RCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGRGLEQRVDRAFA
LARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLKGKQESPDYSERLAKVAPVLKERMV
KEGSMMIGYQPHGPRGNFFRVVVANPALTRADMDFLLSELERLGRDL
Download sequence
Identical sequences ENSDNOP00000009992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]