SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015233 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015233
Domain Number 1 Region: 211-458
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.33e-87
Family Eukaryotic proteases 0.000094
Further Details:      
 
Domain Number 2 Region: 115-218
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-16
Family Hepsin, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015233   Gene: ENSDNOG00000019650   Transcript: ENSDNOT00000019649
Sequence length 464
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569509.1:41123:52568:-1 gene:ENSDNOG00000019650 transcript:ENSDNOT00000019649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDDQASKEAQYAEGSPALEIFRAELEAQLQTPKTQQQPISWTGCWCSVRRGCVVLGALG
LLAGVGVGSWLLEVLYLWPPASQPISGILQDEETTSSCSGARSEEALLPPPPKTVSFRIS
TEDFLLEVQIGGRPTWLLVCHEGWSSAFGMQICWSLGHLRLAHHKGVNLSDIKFNSSQGF
AQLSPRLESLQEEVWQRRDNCTSGRIVSLKCSECGARPLASRIVGGQAAVPGRWPWQASV
ALGSRHMCGGSVLAPHWVVTAAHCMLSFRLSRLSSWRVYTGLLSLSAARPHQGAVVERII
PHPLYSAQTHDYDVALLRLRMPLNFSDTVGAVCLPAQGQDFPRGSPCWVSGWGHTDPSHS
HSSATLQDTVVPLLSSQLCNSSCVYGGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGA
KWHLVGVVSWGHGCAEPNQPGVYAKVAEFLDWIHDTTSDNMCNI
Download sequence
Identical sequences ENSDNOP00000015233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]