SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000019769 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000019769
Domain Number 1 Region: 249-341
Classification Level Classification E-value
Superfamily TAFH domain-like 1.96e-33
Family TAFH domain-like 0.0000283
Further Details:      
 
Domain Number 2 Region: 650-698
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000251
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000019769   Gene: ENSDNOG00000031698   Transcript: ENSDNOT00000045723
Sequence length 860
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569334.1:4891267:5067477:1 gene:ENSDNOG00000031698 transcript:ENSDNOT00000045723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVRVESTSGTLGAVTKAPVSVCVGSTASQ
PLLKAVPLGTKVASVSAVPKLNSGPRMPAPQMVTAKATNTTILLPANFQLPPGTVVIKSN
SGQLMLVSPQQAVTRTDTTSNITSRPAVPTNTKTVKICTMPNSSSHLVKKVAVVPVQKSA
QIETTVATTVPKSSSVPSVAVPTNVTVTSVKPLNTSTTLKPSNLGTSTVPSNEPNLKAEN
LAAVQTNLSPTMLENVKKCKNFLSMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEAEEF
TRKLYIELKSSPQPHLVPFLKKSVIALRQLIPNSQSFIQQCVQQTSSEVVIATCTTTVNS
PVVTTAVSSIQSEKSIIVSGATTPRTMSMQTLNPLAGPGAAKTGVVTLHSVGPAGVPGGT
TAGTLLLQTSKPLVTSVPNTATTVSLQPEKPVVPGGAVTLALPSVTFGETSPAAICLPSF
KPAITSGGTTSDKPAIDTPVQIKLAQPGPILSQLSGFPQAVKVKHLVVQQPLGGIPEQAA
TLSNSSALTIQKSGQKKMPVNTVIPTSPFPPASILKQITLPGNKILSLQASPNQKNKIKE
NGTTSLRDEDDINDVTSMAGVNLHEENAHILATNSELVGTLVRSCRDEPFLFIGALQKRI
LDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYIPSSDARS
QLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQYR
DANLTALAAIGPRKKRPLESGSGSEGLKDNLLASGTSSLTATKQLLRPRITRVCLRDLIF
CMEQEREMKYSRALYHALLK
Download sequence
Identical sequences XP_004465202.1.11602 ENSDNOP00000019769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]